PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 242aa    MW: 27142 Da    PI: 10.3694
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779105.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.61.6e-231762449
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +n+sn qvtfskRr+g++KKA+EL++LC+aeva+++fs+  k+y +
  XP_009779105.1 17 KNESNLQVTFSKRRAGLFKKASELCTLCGAEVALVVFSPGKKVYSF 62
                    89******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.661666IPR002100Transcription factor, MADS-box
SMARTSM004325.6E-31665IPR002100Transcription factor, MADS-box
CDDcd002652.44E-33776No hitNo description
SuperFamilySSF554551.44E-26780IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-18828IPR002100Transcription factor, MADS-box
PfamPF003192.7E-251562IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MARRSKGRQK VDMVKMKNES NLQVTFSKRR AGLFKKASEL CTLCGAEVAL VVFSPGKKVY  60
SFGHPCVDSV VDRFLTRNYP PNNGHDQLIV AHRNASVRDL NMELMNIEGI LQMEKNRGEA  120
LQARKRDNDH WWEAPIEELN FFQLQQLKEA MESIKKKVER KVQNQQMVTS NAFPFLTFGS  180
AFAPIDARAR SSYGSYGSFP FQNMVSGLNF GAPFANSTSG STSSVVPVIP ENPGTSRPSM  240
RN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-14794188Myocyte-specific enhancer factor 2A
3p57_I1e-14794188Myocyte-specific enhancer factor 2A
3p57_D1e-14794188Myocyte-specific enhancer factor 2A
3p57_C1e-14794188Myocyte-specific enhancer factor 2A
3p57_B1e-14794188Myocyte-specific enhancer factor 2A
3p57_A1e-14794188Myocyte-specific enhancer factor 2A
3kov_J1e-14794188Myocyte-specific enhancer factor 2A
3kov_I1e-14794188Myocyte-specific enhancer factor 2A
3kov_B1e-14794188Myocyte-specific enhancer factor 2A
3kov_A1e-14794188Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779105.10.0PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_016493006.10.0PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK24e-57AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLK4B2P01e-100K4B2P0_SOLLC; Uncharacterized protein
STRINGSolyc01g106730.1.12e-99(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-58AGAMOUS-like 62